PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_F7B9CBA99.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 87aa    MW: 9983.48 Da    PI: 10.7131
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_F7B9CBA99.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-17552148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+ Ed ll ++v+q G g+W+++a+  g++R++k+c++rw +yl
  Traes_4BL_F7B9CBA99.1  5 KGPWTALEDRLLTEYVQQQGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 52
                           79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.646156IPR017930Myb domain
SMARTSM007171.8E-13454IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-21455IPR009057Homeodomain-like
PfamPF002493.3E-16552IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-23681IPR009057Homeodomain-like
CDDcd001671.32E-9752No hitNo description
PROSITE profilePS500904.6935380IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.6E-95680IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
GAWRKGPWTA LEDRLLTEYV QQQGEGSWNS VAKLTGLRRS GKSCRLRWVN YLRPDLKRGK  60
ITADEETVIL QLHAMLGNSW VRGRCLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-1758127102MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604506e-97EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562106.11e-48PREDICTED: transcription factor WER-like
SwissprotA2WW872e-33GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC22e-33GAM1_ORYSJ; Transcription factor GAMYB
SwissprotQ9SSA15e-34MYB57_ARATH; Transcription factor MYB57
TrEMBLW5E8H55e-58W5E8H5_WHEAT; Uncharacterized protein
STRINGMLOC_9927.22e-48(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-40myb domain protein 305
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]